PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.16G029800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family Dof
Protein Properties Length: 345aa    MW: 37727 Da    PI: 8.5576
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.16G029800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.91.3e-3951111262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  Manes.16G029800.1.p  51 PQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 111
                          7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027019.4E-3453109IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-2854109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52555109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGNCEKMVVI SPTTNEWPQT QIDEKNSMAS TSKLMEKQGQ ELSQQHHQLQ PQQALKCPRC  60
DSSNTKFCYY NNYSLSQPRH FCKACKRYWT RGGTLRNVPV GGGCRKNKRV KRAASAVEGG  120
ASASSANPNP PSQTQIDISS NSNHINPLFY GLPTNPSGMN LPFPGRFNSK VSSSVDTVSG  180
YDLQPQLNAL ALGFSSGIMS NEANGFNPTK QIQDVVTSSS LLSNYSIFSA SSSTITTSTT  240
MATLLASNFH QQKFSIKDSR APNHFQTFED LQMSGNSESG ISMKEVKMEQ EQSRLNWNMP  300
CQNQIEQIGF SSSDPSIYWN TATSNTIGAW HDPTNIGSSV TSLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012091630.11e-178PREDICTED: dof zinc finger protein DOF1.4 isoform X1
TrEMBLA0A067JDZ71e-178A0A067JDZ7_JATCU; Uncharacterized protein
STRINGVIT_10s0003g00040.t011e-142(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.22e-37Dof family protein